Package: piecepackr 1.15.0-2

piecepackr: Board Game Graphics
Functions to make board game graphics with the 'ggplot2', 'grid', 'rayrender', 'rayvertex', and 'rgl' packages. Specializes in game diagrams, animations, and "Print & Play" layouts for the 'piecepack' <https://www.ludism.org/ppwiki> but can make graphics for other board game systems. Includes configurations for several public domain game systems such as checkers, (double-18) dominoes, go, 'piecepack', playing cards, etc.
Authors:
piecepackr_1.15.0-2.tar.gz
piecepackr_1.15.0-2.zip(r-4.5)piecepackr_1.15.0-2.zip(r-4.4)piecepackr_1.15.0-2.zip(r-4.3)
piecepackr_1.15.0-2.tgz(r-4.5-any)piecepackr_1.15.0-2.tgz(r-4.4-any)piecepackr_1.15.0-2.tgz(r-4.3-any)
piecepackr_1.15.0-2.tar.gz(r-4.5-noble)piecepackr_1.15.0-2.tar.gz(r-4.4-noble)
piecepackr_1.15.0-2.tgz(r-4.4-emscripten)piecepackr_1.15.0-2.tgz(r-4.3-emscripten)
piecepackr.pdf |piecepackr.html✨
piecepackr/json (API)
NEWS
# Install 'piecepackr' in R: |
install.packages('piecepackr', repos = c('https://piecepackr.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/piecepackr/piecepackr/issues
Pkgdown site:https://trevorldavis.com
- spdx_license_list - SPDX License List data
Last updated 14 hours agofrom:3a0a372607. Checks:4 OK, 4 NOTE. Indexed: yes.
Target | Result | Latest binary |
---|---|---|
Doc / Vignettes | OK | Feb 21 2025 |
R-4.5-win | OK | Feb 21 2025 |
R-4.5-mac | OK | Feb 21 2025 |
R-4.5-linux | OK | Feb 21 2025 |
R-4.4-win | NOTE | Feb 21 2025 |
R-4.4-mac | NOTE | Feb 21 2025 |
R-4.3-win | NOTE | Feb 21 2025 |
R-4.3-mac | NOTE | Feb 21 2025 |
Exports:AA_to_Raabb_pieceaes_pieceanimate_pieceas_pp_cfgbasicPieceGrobbreaks_countingcleavecropmarkGrobcrosshairGrobfile2grobgame_systemsgeom_pieceget_embedded_fontgrid.cropmarkgrid.crosshairgrid.piecehas_fontinchinstall_ppverseis_color_invisibleis_pp_cfglabel_countinglabel_lettermarbles_transformop_transformpicturePieceGrobFnpiecepiece_meshpiece3dpieceGrobpkgs_ppversepmap_piecepp_cfgpp_shapepreviewLayoutGrobpyramidTopGrobR_to_AAR_xR_yR_zrender_piecesave_ellipsoid_objsave_peg_doll_objsave_piece_imagessave_piece_objsave_print_and_playscale_x_piecescale_y_piecesegmentsCrosshairGrobsquaresCrosshairGrobto_degreesto_hexpackto_rto_radiansto_subpackto_tto_xto_y
Dependencies:affinerbase64encclifansigluegridGeometrygrImport2jpeglifecyclemagrittrpillarpkgconfigpngpolyclippurrrR6rlangstringistringrtibbleutf8vctrsXML
Readme and manuals
Help Manual
Help page | Topics |
---|---|
piecepackr: Board Game Graphics | piecepackr-package piecepackr |
Helper functions for making geometric calculations. | AA_to_R geometry_utils R_to_AA R_x R_y R_z to_degrees to_r to_radians to_t to_x to_y |
Calculate axis-aligned bounding box for set of game pieces | aabb_piece |
Animate board game pieces | animate_piece |
Piece Grob Functions | basicPieceGrob basicPieceGrobs picturePieceGrobFn previewLayoutGrob pyramidTopGrob |
Font utility functions | font_utils get_embedded_font has_font |
Standard game systems | game_systems to_hexpack to_subpack |
Draw board game pieces with ggplot2 | aes_piece geom_piece |
Draw crop marks with grid | cropmarkGrob grid.cropmark |
Draw crosshairs with grid | crosshairGrob grid.crosshair segmentsCrosshairGrob squaresCrosshairGrob |
Draw board game pieces with grid | grid.piece pieceGrob |
Install additional packages from the piecepackr universe | install_ppverse pkgs_ppverse |
Oblique projection helper function | marbles_transform op_transform |
Create rayrender board game piece objects | piece |
Create rayvertex board game piece objects | piece_mesh |
Render board game pieces with rgl | piece3d |
Defunct functions | checkersGrob concaveGrobFn convexGrobFn get_shape_grob_fn gridlinesGrob halmaGrob hexlinesGrob kiteGrob matGrob piecepackr-defunct pyramidGrob |
Create graphics using data frame input | pmap_piece |
Configuration list R6 object | as_pp_cfg is_pp_cfg pp_cfg |
Shape object for generating various grobs | pp_shape |
Miscellaneous 'piecepackr' utility functions | cleave file2grob inch is_color_invisible pp_utils |
Render image of game pieces | render_piece |
Alternative Wavefront OBJ file generators | save_ellipsoid_obj save_peg_doll_obj |
Save piecepack images | save_piece_images |
Save Wavefront OBJ files of board game pieces | save_piece_obj |
Save piecepack print-and-play (PnP) file | save_print_and_play |
ggplot2 game diagram scales | breaks_counting label_counting label_letter scale_x_piece scale_y_piece |
SPDX License List data | spdx_license_list |